PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00084832001
Common NameGSBRNA2T00084832001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 380aa    MW: 42053.5 Da    PI: 7.2056
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00084832001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.66.9e-29140194156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          kp+++WtpeLH++Fv+aveqL G++kA+P++ile+m+vk+Lt+++v+SHLQkYR++
  GSBRNA2T00084832001 140 KPKVDWTPELHRNFVQAVEQL-GIDKAVPSRILEIMNVKSLTRHNVASHLQKYRSH 194
                          79*******************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.747137196IPR017930Myb domain
SuperFamilySSF466891.7E-19138197IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28138197IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-27140194IPR006447Myb domain, plants
PfamPF002493.1E-7143192IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MLTVSLLIVN TTSRENYMAA DFSDFTTEGL PDFTMVGEGS LDLLGGIDYY DDFFIGFDGD  60
DALPDLEIDC DILGEYSGSG RDDEQEMEGN SSTASETSER DGGVVKLDGG DITHKMVRRG  120
KRKGKKNKDC LSVDNEIKKK PKVDWTPELH RNFVQAVEQL GIDKAVPSRI LEIMNVKSLT  180
RHNVASHLQK YRSHRKHLLA REAEAASWNL RRHTTVAVAG LGGKKPWMAP ALGYRPNVTQ  240
MHHGHFRPLH VWGHPTWPKH KHNHPSSSTH RRYQIPAVAA PPSSWPGQPP YWHQQALYPQ  300
GYGMATPNHS IIGVPTRQLS PTTNPPIDIH PSNESIDAAI GDVITKPWLP LPLGLKPPSV  360
DGVMTELQRQ GVPNVPPLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17138192357ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRGKRKGKK
2120128KRKGKKNKD
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00084832001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009123934.10.0PREDICTED: transcription activator GLK2-like
SwissprotQ9FFH00.0GLK2_ARATH; Transcription activator GLK2
TrEMBLA0A078FRG90.0A0A078FRG9_BRANA; BnaA02g22550D protein
STRINGBra036015.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.11e-173GOLDEN2-like 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]